PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462902599
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family B3
Protein Properties Length: 129aa    MW: 14577.6 Da    PI: 4.8671
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462902599genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B359.36.6e-1911841489
               T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
         B3 14 grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89
               +++ +p +f++e+    +++k++tl d++g+ Wev++ y+++++   +++GW eF+  n+L+  D++vF+l ++++
  462902599 11 AQINIPSEFVREYLP--QSGKKMTLWDPQGKPWEVQYVYNNQRSIAAFSGGWGEFAVGNNLEKFDVCVFELLNEDN 84
               6789*********63..47789*********************99*************************876544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086313.084193IPR003340B3 DNA binding domain
CDDcd100175.01E-23491No hitNo description
SMARTSM010191.9E-10593IPR003340B3 DNA binding domain
SuperFamilySSF1019361.33E-20691IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.2E-22791IPR015300DNA-binding pseudobarrel domain
PfamPF023621.4E-161088IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 129 aa     Download sequence    Send to blast
MEEATDSCLL AQINIPSEFV REYLPQSGKK MTLWDPQGKP WEVQYVYNNQ RSIAAFSGGW  60
GEFAVGNNLE KFDVCVFELL NEDNIKAHIY RIVLQITPLL CNKSIQPLAS NCISIGRQEG  120
EKFIHGLNG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978926.12e-42PREDICTED: B3 domain-containing protein Os11g0197600-like
SwissprotQ2R9D26e-44Y1176_ORYSJ; B3 domain-containing protein Os11g0197600
TrEMBLA0A0A9IA088e-44A0A0A9IA08_ARUDO; Uncharacterized protein
TrEMBLA0A0A9NR786e-44A0A0A9NR78_ARUDO; Uncharacterized protein
TrEMBLA0A0D3HJ803e-42A0A0D3HJ80_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0F3903e-42A0A0E0F390_9ORYZ; Uncharacterized protein
TrEMBLK3ZLC33e-42K3ZLC3_SETIT; Uncharacterized protein
STRINGSi027380m8e-42(Setaria italica)
STRINGLOC_Os11g09160.12e-41(Oryza sativa Japonica Group)
STRINGBGIOSGA034352-PA2e-41(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44613766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42700.15e-09B3 family protein